PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G106400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 317aa    MW: 34214.6 Da    PI: 7.6031
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G106400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.51.8e-55111371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL+kkv++ ++++  +++e+d++k+ePwdLp+ ++ +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkdk+
  Brast09G106400.1.p  11 LPPGFRFHPTDEELITHYLAKKVADARFTA-FAVSEADLNKCEPWDLPSLARMGEKEWYFFCLKDRKYPTGLRTNRATESGYWKATGKDKD 100
                         79*************************999.56***************8778899************************************ PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ kg+lvg+kktLvfy+grapkgek+ Wvmheyrl
  Brast09G106400.1.p 101 IFRGKGALVGMKKTLVFYTGRAPKGEKSGWVMHEYRL 137
                         ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-656157IPR003441NAC domain
PROSITE profilePS5100559.87311157IPR003441NAC domain
PfamPF023656.8E-3012137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEHEEQQAMD LPPGFRFHPT DEELITHYLA KKVADARFTA FAVSEADLNK CEPWDLPSLA  60
RMGEKEWYFF CLKDRKYPTG LRTNRATESG YWKATGKDKD IFRGKGALVG MKKTLVFYTG  120
RAPKGEKSGW VMHEYRLHGK STASSKNEWV LCRVFKKSLV GVVVASSSAS AAKKGAVGME  180
EMTGTTSSMA AVTATQLPPL LDMSGAGFVD PAAHVTCFSN NALEAAGSHG HGHFFNSTTA  240
DYAQYGLVQL LESSSGGYRG GLGMAPCKQQ QPAAACKEML MSASQDTGLT SDAHPEISSS  300
SGGAQKFDHE PALWGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D9e-56215711168NAC domain-containing protein 19
3swp_C9e-56215711168NAC domain-containing protein 19
3swp_B9e-56215711168NAC domain-containing protein 19
3swp_A9e-56215711168NAC domain-containing protein 19
3swm_D9e-56215711168NAC domain-containing protein 19
3swm_C9e-56215711168NAC domain-containing protein 19
3swm_B9e-56215711168NAC domain-containing protein 19
3swm_A9e-56215711168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0995271e-163FP099527.1 Phyllostachys edulis cDNA clone: bphyem118k06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579905.10.0PREDICTED: NAC domain-containing protein 92
RefseqXP_010239990.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9FLJ23e-93NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0Q3KS980.0A0A0Q3KS98_BRADI; Uncharacterized protein
STRINGBRADI5G12407.11e-180(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27303787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.12e-88NAC domain containing protein 100